PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015875882.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB
Protein Properties Length: 331aa    MW: 36567.6 Da    PI: 5.2106
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015875882.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-141865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
   XP_015875882.1 18 KGLWSPEEDDKLMNYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 65
                     678*******************************************97 PP

2Myb_DNA-binding52.31.3e-1671114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
   XP_015875882.1  71 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 114
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-231268IPR009057Homeodomain-like
PROSITE profilePS5129416.2941365IPR017930Myb domain
SuperFamilySSF466899.77E-2816112IPR009057Homeodomain-like
SMARTSM007171.3E-91767IPR001005SANT/Myb domain
PfamPF002493.1E-131865IPR001005SANT/Myb domain
CDDcd001672.75E-82165No hitNo description
PROSITE profilePS5129425.91866120IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2669121IPR009057Homeodomain-like
SMARTSM007174.9E-1670118IPR001005SANT/Myb domain
PfamPF002492.0E-1571114IPR001005SANT/Myb domain
CDDcd001671.26E-1173113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MRKPEPSGKN NSNNKLRKGL WSPEEDDKLM NYMLNNGQGC WSDVARNAGL QRCGKSCRLR  60
WINYLRPDLK RGAFSPQEEE LIIHLHSLLG NRWSQIAARL PGRTDNEIKN FWNSTIKKRL  120
KNLSSTPSPN TSDSSSDAME ALNINPACRQ DSGMISMYMD SSPTSMQSQW NNIHRAPLPV  180
LEHGLNVFGA NGYLNSSSQC MTQMGIIGGC DGFFGDHNNG GGGGGGVLLG VADNIGAEGE  240
LFVPPLETEE SFKSERSIHG RNCNNGNYFN TSTNTNNVVA KINNSDNVKS ENLAGGVESC  300
FQDDQDQLII GDWDFEDLMK DVSSFPFLDF Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27161205108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015875881.10.0PREDICTED: transcription factor MYB46
RefseqXP_015875882.10.0PREDICTED: transcription factor MYB46-like
TrEMBLW9RIA11e-123W9RIA1_9R
STRINGGLYMA11G14200.21e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-62myb domain protein 46